PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009104725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 331aa    MW: 35865.9 Da    PI: 9.1514
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009104725.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222061e-63171551144
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     ++++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqG+y+lpk++DnneVlkALc eAGwvve+DGttyrkg+kpl   e+ag+s +    ss++
  XP_009104725.1  17 AAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGGYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYRKGCKPL-PGEIAGTSYH--HYSSQN 108
                     5899************************************************************************.9999999865..455656 PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvls 144
                     +s+ ssa++sp++sy+ sp+sssfpsps+ + ++++  ++++p+l + +
  XP_009104725.1 109 QSPLSSAFQSPIPSYQVSPSSSSFPSPSRGEPNNNS--STFFPFLGNGG 155
                     689***************************999887..67777776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.4E-5819139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MTSDGATSTS AAAAAAAAAR RKPSWREREN NRRRERRRRA VAAKIYTGLR AQGGYNLPKH  60
CDNNEVLKAL CSEAGWVVEE DGTTYRKGCK PLPGEIAGTS YHHYSSQNQS PLSSAFQSPI  120
PSYQVSPSSS SFPSPSRGEP NNNSSTFFPF LGNGGIPSSL PSLRISNSCP VTPPLSSPTS  180
KNPKPLPNWE SIAKQSMANA KQSMASFNYP FYAVSAPASP THRQFHAPAT IPECDESDAS  240
TVDSGHWISF QKFAQQQPFS GSMVPTSPTF NLVKPPPAAQ MMSPNVALQE IGQSSEFKFE  300
NRQVKPWEGE MIHDVGMEDL ELTLGNGKAR G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11938RRKPSWRERENNRRRERRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.136800.0seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531910.0AK353191.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-32-A21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104725.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1
SwissprotQ8S3070.0BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM4CHT90.0M4CHT9_BRARP; Uncharacterized protein
STRINGBra003772.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24722772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-180BES1 family protein